top of page

Molecular Formula: C₃₁₉H₄₉₅N₉₁O₉₆S₇
Molecular Weight: 7365.42 g/mol
Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA
Purity: >99%
Vial Size: 1mg
Storage: -20°C, protect from light

Product Overview

IGF-1 DES represents advanced insulin-like growth factor technology designed for comprehensive muscle growth, neuroprotection, and regenerative medicine research applications. This naturally occurring truncated variant lacks the N-terminal Gly-Pro-Glu tripeptide, creating a 67-amino acid analog with dramatically enhanced bioavailability and tissue-specific activity. Unlike standard IGF-1, DES variant demonstrates 10x greater potency due to reduced binding affinity for IGF binding proteins, enabling superior local tissue effects and direct receptor activation.

Revolutionary Enhanced Bioavailability Mechanism

IGF-1 DES functions through significantly reduced interaction with IGF binding proteins (IGFBPs) that normally sequester and limit standard IGF-1 activity. This structural modification creates enhanced receptor binding affinity while maintaining rapid onset, higher peak activity, and faster clearance compared to native IGF-1. The peptide directly activates IGF-1 receptors on target tissues including skeletal muscle, neurons, fibroblasts, and satellite cells, triggering powerful anabolic cascades through mTOR/PI3K-Akt pathway stimulation without prolonged systemic exposure.

Primary Research Applications

Muscle Hypertrophy & Hyperplasia Studies
Research demonstrates exceptional anabolic effects through enhanced protein synthesis, satellite cell activation, and potential muscle fiber formation. Studies show IGF-1 DES stimulates myogenic regulatory factors, increases myoblast differentiation, and promotes new muscle fiber development through direct local action. Applications include investigating muscle wasting conditions, sarcopenia research, and targeted muscle growth mechanisms in specific tissue regions.

Autism & Neurological Research
Clinical validation reveals significant therapeutic potential in autism spectrum disorders through synaptic restoration and neuronal development enhancement. Studies demonstrate IGF-1 DES improves social interaction, novel-object recognition, contextual fear conditioning, and reduces repetitive behaviors in autism models. Research applications encompass neurodevelopmental disorder studies, synaptic function investigations, and cognitive enhancement research through enhanced neuroplasticity.

Wound Healing & Tissue Repair
Comprehensive studies demonstrate accelerated wound closure, enhanced keratinocyte migration, increased collagen synthesis, and improved neovascularization through VEGF-independent pathways. Research shows IGF-1 DES promotes fibroblast proliferation, matrix remodeling, and tissue regeneration particularly effective in diabetic wound healing models. Applications include chronic wound research, burn injury studies, and surgical recovery investigations.

Neuroprotection & Cognitive Enhancement
Research reveals significant brain penetration capabilities with enhanced synaptic transmission producing 40% increases in excitatory post-synaptic potential. Studies demonstrate protection against ischemia, Alzheimer's pathology, and age-related cognitive decline through direct CNS effects. Applications include stroke recovery research, neurodegenerative disease studies, and cognitive aging investigations.

Cancer Research Applications
Studies demonstrate ability to force cancer cell differentiation, slowing tumor growth through inhibition of undifferentiated cell proliferation. Research shows IGF-1 DES promotes cellular maturation in various cancer cell lines, potentially reducing malignant characteristics. Applications encompass differentiation therapy research, tumor biology studies, and novel anti-cancer mechanism investigations.

Mechanism of Action

Enhanced Receptor Binding: 10x greater potency through reduced IGFBP interaction enabling direct tissue targeting
Satellite Cell Activation: Stimulation of muscle stem cells promoting repair and potential hyperplastic growth
mTOR Pathway Stimulation: Enhanced protein synthesis and anabolic signaling in target tissues
Synaptic Enhancement: Direct CNS effects improving neuronal communication and cognitive function
Angiogenesis Promotion: VEGF-independent vascular development supporting tissue repair
Anti-Inflammatory Effects: Reduced oxidative stress and inflammatory cytokine production

Research Advantages

Superior Potency: 10x more effective than standard IGF-1 enabling lower research doses
Tissue-Specific Action: Direct local effects without systemic IGF binding protein interference
Rapid Onset: Fast-acting with higher peak activity for acute research applications
Enhanced Bioavailability: Superior tissue penetration including blood-brain barrier crossing
Clinical Relevance: Naturally occurring variant found in brain, breast milk, and reproductive tissues
Multi-System Applications: Simultaneous muscle, neural, vascular, and immune research potential
Safety Profile: Well-characterized pharmacokinetics with established clearance patterns

Quality Specifications

Every IGF-1 DES batch undergoes comprehensive quality control:

  • HPLC-MS purity analysis confirming >99% purity

  • Complete 67-amino acid sequence verification

  • Molecular weight confirmation at 7365.42 g/mol

  • CAS number validation (112603-35-7)

  • PubChem CID verification (135331146)

  • Endotoxin testing (<0.1 EU/mg)

  • Certificate of Analysis provided with shipment

Storage & Reconstitution

Store lyophilized powder at -20°C in sealed vials. Protect from light and humidity. Reconstitute with sterile bacteriostatic water immediately before use. Once reconstituted, use within 24 hours or store at -80°C for short-term applications. Avoid repeated freeze-thaw cycles to maintain receptor binding affinity and biological potency.

Research Protocol Applications

  • Muscle hypertrophy and hyperplasia mechanism studies

  • Autism spectrum disorder and neurodevelopmental research

  • Wound healing and tissue regeneration investigations

  • Neuroprotection and cognitive enhancement studies

  • Cancer cell differentiation and tumor biology research

  • Satellite cell activation and muscle repair studies

  • Synaptic function and neuroplasticity investigations

  • Anti-aging and cellular longevity research

Clinical Translation Potential

IGF-1 DES benefits from extensive research validation across multiple therapeutic areas with proven mechanisms in muscle growth, neurological enhancement, and tissue repair. The peptide's natural occurrence and enhanced bioavailability profile provide strong foundation for investigating novel therapeutic applications in muscle wasting disorders, neurodevelopmental conditions, and regenerative medicine.

Research Use Only: Not for human or veterinary therapeutic applications. Handle according to laboratory safety protocols and institutional research guidelines.

IGF-1 DES 1mg

₹22,000.00Price
Quantity
bottom of page